PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016468082.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 314aa    MW: 35834.6 Da    PI: 5.1776
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016468082.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.51.1e-163275146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     rg++T++E+  ++d+++ lG++ W+ Ia++++ gRt++++k++w++
   XP_016468082.1 32 RGSFTEQEERTIIDVHRILGNR-WAQIAKHLP-GRTDNEVKNFWNS 75
                     89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.135126IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.609.1E-111238IPR009057Homeodomain-like
SuperFamilySSF466897.52E-211385IPR009057Homeodomain-like
PROSITE profilePS5129425.9772781IPR017930Myb domain
SMARTSM007171.5E-153179IPR001005SANT/Myb domain
PfamPF002492.3E-153275IPR001005SANT/Myb domain
CDDcd001674.67E-123474No hitNo description
Gene3DG3DSA:1.10.10.602.1E-203977IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MLKEYSPEDG LQRCGKSCRL RWINYLRPDL RRGSFTEQEE RTIIDVHRIL GNRWAQIAKH  60
LPGRTDNEVK NFWNSCIKKK LIAQGLDPNT HNLLKNKTNN STKAKTNYHQ DSTSVFTIDT  120
STNKEVISMD IKAALASFSP FPHGSNTTTC NTYNYTPIVP NIEYQNPTFT WSGQRNQTAI  180
TTPPSQSSDR NHIITQNSML DFASSSLMES STNIRQGETE YINENSMWHG TGIEPTTLNP  240
ANGPEELMQV QQGEQFPIQT NFCDQEDVYK INHDQTVENT FDSSNFDFDF VDSTLMPCGL  300
YTNVNSMDQL SWDC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-25138140108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00350DAPTransfer from AT3G12720Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754491e-107HG975449.1 Solanum pennellii chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016468082.10.0PREDICTED: myb-related protein 330-like isoform X2
TrEMBLK4CX571e-142K4CX57_SOLLC; Uncharacterized protein
STRINGSolyc10g005240.2.11e-142(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12720.13e-50myb domain protein 67